Shanghai Pemichem Lab Supply Raw Materials Pharmaceutical Intermediates Powder Teriparatide Acetate CAS52232-67-4 API with 99% Pruity

Price $10.00 Compare
Min Order 1 kg
Availability In Stock
Shipping From Shanghai, China
Popularity 392 people viewed
Quantity
+-
 

Shanghai Pemichem Biotechnology Co., Ltd.

VIP   Audited Supplier 1 year
Profile Certified by SGS/BV
Pemi-0270
52232-67-4
C172h278n52o47s2
640-978-1
Pharmaceutical Grade
GR
Standard
Laboratory Reagents
Concrete
Fine Chemicals
Scientific Research
Organic Reagent
3890.49792
Penicillin Bottle, Aluminium Foil Bag
1g, 100g
Shanghai
Product Description




1.For some materials, we could supply free Samples for testing at first..
2.MOQ: 1g or 5g
3.More than 3000 kinds of materials in stock.
4.More than 11+ manufacturing experience.
5.Certification: MSDS,HALAL,COA,IFRA,ISO9001, ISO22000,26 Allergens, etc.
6.Lead time:about 8-12 working days.
8.Verified by Made-in-China as Golden Supplier.

9.We will reply you for your inquiry in 24 hours.
10. Our Q&C team will inspect every product quality strictly before delivery.








What is CAS 52232-67-4 Teriparatide acetate Powder 
 
Product Name:Teriparatide acetate
Synonyms:PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE
CAS:52232-67-4
MF:C172H278N52O47S2
MW:3890.49792
EINECS:640-978-1
Product Categories:Amino Acid Derivatives;EndocrinologyandHormones;Peptide;Hormones;Other Protein/Pep tide Hormones;proteins;Parathyroid Hormone (PTH)Peptides and Proteins;Parathyroid Hormone Fragments;Peptides for Cell Biology;Peptides and Proteins;Various Peptides;52232-67-4
Mol File:52232-67-4.mol
        
A fragment of human parathyroid hormone (hPTH) peptide sequence containing the 34 N-terminal residues of hPTH. This fragment was also found to be an agonist at PTH1 and PTH2 receptors.
 


 
 
 
 



ShangHai Pemichem is one of professional company specialized in research, development, custom manufacturing and trading of pharmaceutical API, advanced intermediates, Cosmetic raw materials, health and new raw materials, polypeptides, animal drug and organic reagent  etc. 
You can select more than 2000 kinds of raw ingredients here. And we are keeping developing new products and continuously marketing them for sale. You will save lots of time , energy, money and have a very pleasant cooperation with us!

Our purpose: Trransaction is not the end, but the satarting of service!


 

Q&A

1.How could l get a sample?
Before we received the first order, please afford the sample cost and express fee. We will return the sample cost back to you within your first order.

2.Can you make designs for us?
We have a professional design team to help our customers do design work.Both OEM and ODM    orders are accepted.


3.Whether you could make our brand on your products?
Yes. We can print your Logo on both the products and the packages if you can meet our MOQ.

4.How can you provide us high quality products?
We have a professional QC team, every product is shipped after strictly examination.

5.What is your lead time?
7-15days, We will update you eact two-three days!

6.What is your payment?
We accept T/T.L/C.Paypal.Westem union or to be negotiated.Don't worry about anything, if you have      any problems, please feel free to contact us

 
 
  • Contact Supplier
Message Type
* Message Content
* Name  
* Phone
* Email
* CAPTCHA  
$10.00 1 kg(MOQ)

Shanghai Pemichem Lab Supply Raw Materials Pharmaceutical Intermediates CAS 2649467-58-1 Vx-548 (Suzetrigine)

Shanghai Pemichem Biotechnology Co., Ltd.
$10.00 1 g(MOQ)

Shanghai Pemichem Lab Supply Raw Materials Pharmaceutical Intermediates Powder Retatrutide CAS 2381089-83-2 API with 99% Pruity

Shanghai Pemichem Biotechnology Co., Ltd.
$10.00 1 kg(MOQ)

Shanghai Pemichem Lab Supply Raw Materials Pharmaceutical Intermediates Powder Teriparatide Acetate CAS52232-67-4 API with 99% Pruity

Shanghai Pemichem Biotechnology Co., Ltd.
$10.00 1 g(MOQ)

Shanghai Pemichem Lab Supply Raw Materials Pharmaceutical Intermediates Powder BENZOIC ACID, 2-[[(2'-CYANO[1, 1'-BIPHENYL]-4-YL)METHYL]AMINO CAS 139481-28-0 API

Shanghai Pemichem Biotechnology Co., Ltd.
$20000.00 1 Ton(MOQ)

The Manufacturer of Precipitated Silica Powder Silicon Dioxide White Carbon Black Sio2

Shenyang Mstoney New Material Technology Co., Ltd.
$45.50 200 kg(MOQ)

Superior Lithium Fluoride Powder for Advanced Manufacturing Needs CAS 7789-24-4

Shanghai Mingyi New Materials Co., Ltd.
$10.00 1 box(MOQ)

2024 Wholesale 99% Purity Peptide for Weight Loss

Zhengzhou Strong Peptide Cross-Border E-Commerce Co., Ltd.
$3.60 10000 kg(MOQ)

Sulfonated Asphalt (High purity) FF-I for Drilling Fluid

Shandong Deshunyuan Petroleum Sci&Tech Co., Ltd.
$600.00 22 Tons(MOQ)

Calcium Carbide Manufacturer Size 50-80mm with Cheap Price and Fast Delivery

Ningxia Wanding Chemical Co., Ltd
$10.00 1 kg(MOQ)

High Quality 99% Powder Hot Sale L-Epinephrin Hydrochloride 55 31 2 Factory Price L-Adrenalin Hydrochloride

Wuhan Newtop Biotech Co., Ltd